PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_04422.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 326aa    MW: 35058.4 Da    PI: 9.2437
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_04422.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.56.8e-3978137362
                   zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                              e+alkcprC+stntkfCy+nnysl+qPr+fCk+CrryWt+GGalrnvPvGgg+r+n++++
  Rsa1.0_04422.1_g00002.1  78 EAALKCPRCESTNTKFCYFNNYSLTQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNRRTK 137
                              7789*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3861135IPR003851Zinc finger, Dof-type
PfamPF027013.9E-3280135IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.47881135IPR003851Zinc finger, Dof-type
PROSITE patternPS01361083119IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MVFSSIQAYL DSSNWQQAPQ SNYNQGGAGA SATGGHGLRP QMQPQPQQPQ SNVSGGSGSI  60
RPGSMVDRAR QANVAMPEAA LKCPRCESTN TKFCYFNNYS LTQPRHFCKT CRRYWTRGGA  120
LRNVPVGGGC RRNRRTKSSS NNNSSTATSN NTSFSSAASG NASTISAILS SNYGGTHENI  180
LSQILSPGRL MNANYNHHLG DLTDNTKTDN NMSLLNYGGL SQDLRSIHMG TSGGSLMSCV  240
DEWRTASHHQ QPQILGGGNL EDSNPNPSSN GFYPFESPRI TSASISSALA SQFSSVKVED  300
NNPYKWVNVN GNCSSWTDLS TFGSSR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1121134RNVPVGGGCRRNRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00295DAPTransfer from AT2G37590Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009143473.10.0PREDICTED: dof zinc finger protein DOF2.4 isoform X1
SwissprotO809281e-168DOF24_ARATH; Dof zinc finger protein DOF2.4
TrEMBLM4CLU40.0M4CLU4_BRARP; Uncharacterized protein
STRINGBra005181.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM113541732
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.11e-150DNA binding with one finger 2.4